PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00802g00244.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 565aa    MW: 63363.4 Da    PI: 6.3034
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00802g00244.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.54.7e-11108149446
                               S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                               W ++E+ ll+++++++G  +W+ +a+++g +++  qc++++++
  Peaxi162Scf00802g00244.1 108 WNADEEMLLLEGIEMYGLANWAEVAEHVG-TKSKMQCIDHYNS 149
                               *****************************.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250241.8E-15736565IPR016827Transcriptional adaptor 2
SMARTSM002916.2E-104489IPR000433Zinc finger, ZZ-type
PfamPF005692.3E-104689IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.9364891IPR000433Zinc finger, ZZ-type
CDDcd023356.47E-244896No hitNo description
SuperFamilySSF578501.77E-1348111No hitNo description
PROSITE patternPS0135705077IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.05E-12101154IPR009057Homeodomain-like
PROSITE profilePS5129321.094103155IPR017884SANT domain
SMARTSM007172.7E-11104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-8107150IPR009057Homeodomain-like
PfamPF002495.2E-11108149IPR001005SANT/Myb domain
CDDcd001671.56E-11108150No hitNo description
SuperFamilySSF466895.38E-18471562IPR009057Homeodomain-like
PROSITE profilePS509348.899479565IPR007526SWIRM domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 565 aa     Download sequence    Send to blast
MGRSRAVHQP ADDDPSQRSK RKRIAQNVET FDTAAAGQIL SDGKKALYHC NYCNKDISGR  60
IRIKCVVCSD FDLCVECFSV GAEVHPHKSN HLYRVMDNLS FPLICADWNA DEEMLLLEGI  120
EMYGLANWAE VAEHVGTKSK MQCIDHYNSI YINSSCFPIP DMSHVMGKNK EELLAMAKEQ  180
GHAAPGGVNV KEESPLSPKI KMEDQREENS AGLSSDLVSV GGSASGTLSG AGKRTSGILH  240
SKDSHDSIKV EGCPADRSVG EKKPRTSVDE GPSMTELSGY NSKREEFEIE YDNDAEQMLA  300
DMEFKETDSN AERELKLRVL RVYSKRLDER KRRKNFILER NLLHPDPFEK DLTPEEKDIC  360
RCYRVFMRFN SKEEHEDFLR SIIEEHRMIK RIQDLQDARA AGCRTSAEAE KYVEQKRKRE  420
SEENARGLKE SSQNGLSGKY LQRAGHLKVE HDSSPRGVAR GPEMLDSSCK DLSSTTAQHG  480
VGSALDVWDV SGFVGAELLS EADKRLCDEN RILPTHYLNM LQTMSMGILS GNITKKSDAH  540
GLFNVDPNKV DKVYEMLVKK GMAQA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0146080.0BT014608.1 Lycopersicon esculentum clone 134091F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009803647.10.0PREDICTED: transcriptional adapter ADA2-like isoform X1
RefseqXP_016449024.10.0PREDICTED: transcriptional adapter ADA2-like isoform X1
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLK4CEW80.0K4CEW8_SOLLC; Uncharacterized protein
STRINGSolyc07g047610.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24471215